PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016514932.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family B3
Protein Properties Length: 357aa    MW: 42165.3 Da    PI: 8.3963
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016514932.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B350.63.5e-1625116198
                     EEEE-..-HHHHTT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                     ffk++   ++  ++rl++p kf+ +  + + +     +l+ +sg++W v++  r+ ++ yv+ +GW+ Fvk++ L+e D +vFk+++ s+f   v
  XP_016514932.1  25 FFKIM---MNDFRRRLRIPQKFVLNLkD-SYKLLGRKILRGPSGNTWAVEV-KRREDDDYVFCNGWELFVKDHCLEEADLLVFKMKSFSSF--DV 112
                     77777...4556678********88853.4444446678************.4777777*************************7654888..88 PP

                     EEE- CS
              B3  95 kvfr 98 
                     ++f+
  XP_016514932.1 113 SIFD 116
                     8887 PP

2B357.91.8e-18241326189
                     EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89 
                     ff  ++++ +  +g+l lpkk a++++ kk e++ l++ ++sgr+W v +  + ++++ v+++GW++Fv +n+L+e D++vF+l +  +
  XP_016514932.1 241 FFLMTMQPTHVYLGQLKLPKKWANRYMTKKYETINLRI-HSSGRTWAVAV--SYRQEGLVMQSGWEDFVMDNDLEECDICVFELAQGGK 326
                     566677888888999***********988877666664.37*********..777778*************************986543 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.104.9E-2021120IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.70322118IPR003340B3 DNA binding domain
SuperFamilySSF1019364.12E-2022123IPR015300DNA-binding pseudobarrel domain
CDDcd100179.81E-1825116No hitNo description
SMARTSM010191.2E-1025118IPR003340B3 DNA binding domain
PfamPF023623.4E-1325116IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.8E-24235340IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.9E-22236326IPR015300DNA-binding pseudobarrel domain
CDDcd100171.22E-14240340No hitNo description
SMARTSM010192.2E-11241342IPR003340B3 DNA binding domain
PROSITE profilePS5086312.872241336IPR003340B3 DNA binding domain
PfamPF023621.8E-16241329IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MATICETCKV IEKQKYWEEF DKHQFFKIMM NDFRRRLRIP QKFVLNLKDS YKLLGRKILR  60
GPSGNTWAVE VKRREDDDYV FCNGWELFVK DHCLEEADLL VFKMKSFSSF DVSIFDLSAC  120
EKEETFFAKK NRNPCKHPDE VTDEHTSDQK ESSENEHSSE EESYEKKYVF HSSQLGKGKK  180
MKKILIAKQQ INRKRECTPS SPRKKNIEPE EKMPMFSNRR QVTEKEEVFQ QASRHKSSVP  240
FFLMTMQPTH VYLGQLKLPK KWANRYMTKK YETINLRIHS SGRTWAVAVS YRQEGLVMQS  300
GWEDFVMDND LEECDICVFE LAQGGKHNLI PVVLDVYIHR VKDEIMRPSC SNSTSID
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016514932.10.0PREDICTED: B3 domain-containing protein REM16-like
TrEMBLA0A0V0I0F90.0A0A0V0I0F9_SOLCH; Putative B3 domain-containing protein REM16-like
STRINGSolyc02g090170.2.11e-177(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA136031216
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G33280.11e-30B3 family protein